PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P14750_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 286aa    MW: 32310.2 Da    PI: 4.3446
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P14750_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox603.7e-1981134356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k+++++ eq+++Le+ Fe +++++ e++ +LA+ lgL+ rqV vWFqNrRa++k
  GSMUA_Achr2P14750_001  81 KKRRLSVEQVKALEKNFEVENKLDPERKLRLAQDLGLQPRQVAVWFQNRRARWK 134
                            456899***********************************************9 PP

2HD-ZIP_I/II128.62.6e-4180172193
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrls eqvk+LE++Fe e+kL+perK +la++LglqprqvavWFqnrRAR+ktkqlE+dy aLk+++dalk + ++L++++e+L 
  GSMUA_Achr2P14750_001  80 EKKRRLSVEQVKALEKNFEVENKLDPERKLRLAQDLGLQPRQVAVWFQNRRARWKTKQLERDYGALKARHDALKLDCDALSRDNEALL 167
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eelke 93 
                            +e++e
  GSMUA_Achr2P14750_001 168 AEIAE 172
                            99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-1975138IPR009057Homeodomain-like
PROSITE profilePS5007117.13576136IPR001356Homeobox domain
SMARTSM003891.0E-1879140IPR001356Homeobox domain
PfamPF000461.7E-1681134IPR001356Homeobox domain
CDDcd000867.83E-1881137No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2083143IPR009057Homeodomain-like
PRINTSPR000313.0E-5107116IPR000047Helix-turn-helix motif
PROSITE patternPS000270111134IPR017970Homeobox, conserved site
PRINTSPR000313.0E-5116132IPR000047Helix-turn-helix motif
PfamPF021832.0E-17136177IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MVYKENLALS PSPYQVTLSL SLSLSLVDYL VFSLLLQSDL FYLFSVEEKG KYEAVLDGTE  60
ELDGCEEEEP CGTGLSGLGE KKRRLSVEQV KALEKNFEVE NKLDPERKLR LAQDLGLQPR  120
QVAVWFQNRR ARWKTKQLER DYGALKARHD ALKLDCDALS RDNEALLAEI AELKAKLADS  180
GMDAMESETK AVEEERPPLI HKDGASDSDS SVVFNDETSP HAGTVLHQHF LMGFRSQCPF  240
LPFEDKAQAE KGYLDEELLA GEELCSSLFS EQQAPNFSWY CSDEWD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1128136RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009388778.11e-178PREDICTED: homeobox-leucine zipper protein ATHB-16-like
SwissprotQ940J13e-59ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLM0S8160.0M0S816_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P14750_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.12e-50homeobox protein 16